Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED6 Rabbit Polyclonal Antibody (HRP)

MED6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ARC33, NY-REN-28

UniProt

O75586

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human MED6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYILLH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005457

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF488A conjugate, 0.1mg/mL
BNC880151-500 1x 500 µL

CD11a (Cris-3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tmem209 Mouse Gene Knockout Kit (CRISPR)
KN517798 1 Kit

Tmem209 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TIM3 / HAVCR2 / CD366 (Effector T-Cell Marker) (HAVCR2/192), CF647 conjugate, 0.1mg/mL
BNC472399-100 1x 100 µL

TIM3 / HAVCR2 / CD366 (Effector T-Cell Marker) (HAVCR2/192), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Prostate
CB544981 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometriotic tissue
CS626007 5x 5 µm

Frozen Tissue Sections, Endometriotic tissue

Sign In for Pricing
View Details
ARHGAP25 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI11C4]
TA501746BM 100 µL

ARHGAP25 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI11C4]

Sign In for Pricing
View Details