Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEF2A Rabbit Polyclonal Antibody (Biotin)

MEF2A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Mef2, ADCAD1, RSRFC4, RSRFC9

UniProt

Q02078

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MEF2A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005578

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal PTK9 Antibody (OTI5C12) [DyLight 350]
NBP2-73710UV 0.1 mL

Mouse Monoclonal PTK9 Antibody (OTI5C12) [DyLight 350]

Sign In for Pricing
View Details
IL-17R (F-12)
sc-376600 200 µg/mL

IL-17R (F-12)

Sign In for Pricing
View Details
EPSTI1 Adenovirus (Rat)
19389056 1.0 mL

EPSTI1 Adenovirus (Rat)

Sign In for Pricing
View Details
VEGFR2 (VEGF Receptor 2, VEGFR 2, Vascular Endothelial Growth Factor Receptor 2, VEGFR-2, VEGFR, CD309 Antigen, Fetal Liver Kinase 1, FLK1, Kinase Insert Domain Receptor, KDR, KRD1, Ly73, Protein Tyrosine Kinase Receptor FLK1) (Biotin)
MBS6444833-01 0.1 mL

VEGFR2 (VEGF Receptor 2, VEGFR 2, Vascular Endothelial Growth Factor Receptor 2, VEGFR-2, VEGFR, CD309 Antigen, Fetal Liver Kinase 1, FLK1, Kinase Insert Domain Receptor, KDR, KRD1, Ly73, Protein Tyrosine Kinase Receptor FLK1) (Biotin)

Sign In for Pricing
View Details
VEGFR2 (VEGF Receptor 2, VEGFR 2, Vascular Endothelial Growth Factor Receptor 2, VEGFR-2, VEGFR, CD309 Antigen, Fetal Liver Kinase 1, FLK1, Kinase Insert Domain Receptor, KDR, KRD1, Ly73, Protein Tyrosine Kinase Receptor FLK1) (Biotin)
MBS6444833-02 5x 0.1 mL

VEGFR2 (VEGF Receptor 2, VEGFR 2, Vascular Endothelial Growth Factor Receptor 2, VEGFR-2, VEGFR, CD309 Antigen, Fetal Liver Kinase 1, FLK1, Kinase Insert Domain Receptor, KDR, KRD1, Ly73, Protein Tyrosine Kinase Receptor FLK1) (Biotin)

Sign In for Pricing
View Details
Recombinant Pseudomonas putida Protease HtpX (htpX)
MBS1023887 Inquire

Recombinant Pseudomonas putida Protease HtpX (htpX)

Sign In for Pricing
View Details