Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rest Rabbit Polyclonal Antibody (Biotin)

Rest Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

N, NRSF, REST4, D14Mgi1, AA407358, 2610008J04Rik

UniProt

Q8VIG1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ANMGMALTNDMYDLHELSKAELAAPQLIMLANVALTGEASGSCCDYLVGE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

118kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_035393

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Nanog Rabbit Monoclonal Antibody
MBS179148-01 0.03 mL

Anti-Nanog Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Nanog Rabbit Monoclonal Antibody
MBS179148-02 0.1 mL

Anti-Nanog Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Nanog Rabbit Monoclonal Antibody
MBS179148-03 5x 0.1 mL

Anti-Nanog Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ATF2, phosphorylated (Ser322) (Cyclic AMP-dependent Transcription Factor ATF-2, cAMP-dependent Transcription Factor ATF-2, Activating Transcription Factor 2, cAMP Response Element-binding Protein CRE-BP1, HB16, Cyclic AMP-responsive Element-binding Protein 2, cAMP-responsive Element-binding Protein 2, CREB-2, CREB2, CREBP1) (MaxLight 550) discontinued
A0855-42Q-ML550 100 µL

ATF2, phosphorylated (Ser322) (Cyclic AMP-dependent Transcription Factor ATF-2, cAMP-dependent Transcription Factor ATF-2, Activating Transcription Factor 2, cAMP Response Element-binding Protein CRE-BP1, HB16, Cyclic AMP-responsive Element-binding Protein 2, cAMP-responsive Element-binding Protein 2, CREB-2, CREB2, CREBP1) (MaxLight 550) discontinued

Sign In for Pricing
View Details
ArgTX-48 TFA
T70716-01 25 mg

ArgTX-48 TFA

Sign In for Pricing
View Details
ArgTX-48 TFA
T70716-02 50 mg

ArgTX-48 TFA

Sign In for Pricing
View Details