Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rest Rabbit Polyclonal Antibody (FITC)

Rest Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

N, NRSF, REST4, D14Mgi1, AA407358, 2610008J04Rik

UniProt

Q8VIG1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ANMGMALTNDMYDLHELSKAELAAPQLIMLANVALTGEASGSCCDYLVGE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

118kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_035393

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAT13, CT (NAA50, MAK3, NAT13, NAT5, N-alpha-acetyltransferase 50, N-acetyltransferase 13, N-acetyltransferase 5, N-acetyltransferase san homolog, NatE catalytic subunit) (Biotin) discontinued
038805-Biotin 200 µL

NAT13, CT (NAA50, MAK3, NAT13, NAT5, N-alpha-acetyltransferase 50, N-acetyltransferase 13, N-acetyltransferase 5, N-acetyltransferase san homolog, NatE catalytic subunit) (Biotin) discontinued

Sign In for Pricing
View Details
HSPD1P13 CRISPRa sgRNA lentivector (set of three targets)(Human)
24034121 3x 1.0µg DNA

HSPD1P13 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Inhibitor hsa-miR-6852-3p AAV miRNA Vector
Amh3237700 500 ng

Inhibitor hsa-miR-6852-3p AAV miRNA Vector

Sign In for Pricing
View Details
WASH1 ORF Vector (Human) (pORF)
50261011 1.0 µg DNA

WASH1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Gm5634 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
22114154 3x 1.0 µg DNA

Gm5634 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
ALDH8A1 siRNA (Mouse)
CRN3305-01 15 nmol

ALDH8A1 siRNA (Mouse)

Sign In for Pricing
View Details