Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rest Rabbit Polyclonal Antibody (FITC)

Rest Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

N, NRSF, REST4, D14Mgi1, AA407358, 2610008J04Rik

UniProt

Q8VIG1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ANMGMALTNDMYDLHELSKAELAAPQLIMLANVALTGEASGSCCDYLVGE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

118kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_035393

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 Molecule-Like Human Recombinant, HEK
rAP-0048 1 Each

CD5 Molecule-Like Human Recombinant, HEK

Sign In for Pricing
View Details
Nxt2 (NM_001290533) Mouse Tagged ORF Clone
MR227911 10 µg

Nxt2 (NM_001290533) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Kaiso (Zinc Finger and BTB Domain Containing 33, ZBTB33) (MaxLight 490)
MBS6245302-01 0.1 mL

Kaiso (Zinc Finger and BTB Domain Containing 33, ZBTB33) (MaxLight 490)

Sign In for Pricing
View Details
Kaiso (Zinc Finger and BTB Domain Containing 33, ZBTB33) (MaxLight 490)
MBS6245302-02 5x 0.1 mL

Kaiso (Zinc Finger and BTB Domain Containing 33, ZBTB33) (MaxLight 490)

Sign In for Pricing
View Details
ING4 (NM_001127584) Human Tagged ORF Clone
RC225313 10 µg

ING4 (NM_001127584) Human Tagged ORF Clone

Sign In for Pricing
View Details
LOC685909 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6075708 1.0 µg DNA

LOC685909 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details