Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rest Rabbit Polyclonal Antibody (HRP)

Rest Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

N, NRSF, REST4, D14Mgi1, AA407358, 2610008J04Rik

UniProt

Q8VIG1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ANMGMALTNDMYDLHELSKAELAAPQLIMLANVALTGEASGSCCDYLVGE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

118kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_035393

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotinylated Anti-FGF21 antibody (19H8), IgG1 Chimeric mAb
MBS1882408-01 0.01 mg

Biotinylated Anti-FGF21 antibody (19H8), IgG1 Chimeric mAb

Sign In for Pricing
View Details
Biotinylated Anti-FGF21 antibody (19H8), IgG1 Chimeric mAb
MBS1882408-02 0.1 mg

Biotinylated Anti-FGF21 antibody (19H8), IgG1 Chimeric mAb

Sign In for Pricing
View Details
Biotinylated Anti-FGF21 antibody (19H8), IgG1 Chimeric mAb
MBS1882408-03 0.5 mg

Biotinylated Anti-FGF21 antibody (19H8), IgG1 Chimeric mAb

Sign In for Pricing
View Details
Biotinylated Anti-FGF21 antibody (19H8), IgG1 Chimeric mAb
MBS1882408-04 5x 0.5 mg

Biotinylated Anti-FGF21 antibody (19H8), IgG1 Chimeric mAb

Sign In for Pricing
View Details
ZBED2 Antibody FITC Conjugated
orb1542983 100 µL

ZBED2 Antibody FITC Conjugated

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Casein Kappa (CSN3)
MBS2081213-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Casein Kappa (CSN3)

Sign In for Pricing
View Details