Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOLH Rabbit Polyclonal Antibody (Biotin)

SOLH Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SOLH

UniProt

O75808

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SOLH

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FNVVSTRGSLRTQDSVPPLHRQVLVILSQLEGNAGFSITHRLAHRKAAQA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

117kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005623

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human GABRA5 shRNA (UAS) - Lentiviral human GABRA5 shRNA (UAS, GFP) (25)
GTR15099116 1 Vial

Lentiviral human GABRA5 shRNA (UAS) - Lentiviral human GABRA5 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
UBE2C, CT (Ubiquitin-conjugating Enzyme E2 C, Ubiquitin-protein Ligase C, Ubiquitin Carrier Protein C, UbcH10) (PE) discontinued
U1000-86B-PE 200 µL

UBE2C, CT (Ubiquitin-conjugating Enzyme E2 C, Ubiquitin-protein Ligase C, Ubiquitin Carrier Protein C, UbcH10) (PE) discontinued

Sign In for Pricing
View Details
C5orf45 3'UTR GFP Stable Cell Line
TU052357 1.0 mL

C5orf45 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Cluster Of Differentiation 164 (CD164)
MBS2165508-01 0.1 mL

APC-Linked Monoclonal Antibody to Cluster Of Differentiation 164 (CD164)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Cluster Of Differentiation 164 (CD164)
MBS2165508-02 0.2 mL

APC-Linked Monoclonal Antibody to Cluster Of Differentiation 164 (CD164)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Cluster Of Differentiation 164 (CD164)
MBS2165508-03 0.5 mL

APC-Linked Monoclonal Antibody to Cluster Of Differentiation 164 (CD164)

Sign In for Pricing
View Details