Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSX5 Rabbit Polyclonal Antibody (HRP)

SSX5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

O60225

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SSX5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ASGPQNNGKQLRPSGKLNTSEKVNKTSGPKRGKHAWTHRVRERKQLVIYE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human WDR54 Pre-designed siRNA Set B
SI018202B 1 Each

Human WDR54 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Lentiviral mouse Med16 shRNA (UAS) - Lentiviral mouse Med16 shRNA (UAS, RFP) plasmid
GTR15161893 1 Vial

Lentiviral mouse Med16 shRNA (UAS) - Lentiviral mouse Med16 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
IKB alpha/NFKBIA Rabbit Polyclonal Antibody (FITC)
orb2622454 100 µg

IKB alpha/NFKBIA Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Magnetic Fluorescence-encoded Microspheres
MFB100516A-01 1 L

Magnetic Fluorescence-encoded Microspheres

Sign In for Pricing
View Details
Magnetic Fluorescence-encoded Microspheres
MFB100516A-02 100 mL

Magnetic Fluorescence-encoded Microspheres

Sign In for Pricing
View Details
Magnetic Fluorescence-encoded Microspheres
MFB100516A-03 25 mL

Magnetic Fluorescence-encoded Microspheres

Sign In for Pricing
View Details