Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAF6 Rabbit Polyclonal Antibody (Biotin)

TAF6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ALYUS, TAF2E, TAFII70, TAFII80, TAFII85, MGC:8964, TAFII-70, TAFII-80, TAF (II) 70, TAF (II) 80

UniProt

P49848

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TAF6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMG

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005632

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Sclerostin (SOST) CLIA Kit
EKU09793 96 Tests

Rat Sclerostin (SOST) CLIA Kit

Sign In for Pricing
View Details
Rat Monoclonal 4-1BB Ligand/TNFSF9 Antibody (RM0067-3H19) [Alexa Fluor 350]
NBP1-21514AF350 0.1 mL

Rat Monoclonal 4-1BB Ligand/TNFSF9 Antibody (RM0067-3H19) [Alexa Fluor 350]

Sign In for Pricing
View Details
AP4B1 Antibody (Center) [APR14979G]
APR14979G-01 50 µL

AP4B1 Antibody (Center) [APR14979G]

Sign In for Pricing
View Details
AP4B1 Antibody (Center) [APR14979G]
APR14979G-02 100 µL

AP4B1 Antibody (Center) [APR14979G]

Sign In for Pricing
View Details
AP4B1 Antibody (Center) [APR14979G]
APR14979G-03 200 µL

AP4B1 Antibody (Center) [APR14979G]

Sign In for Pricing
View Details
AP4B1 Antibody (Center) [APR14979G]
APR14979G-04 400 µL

AP4B1 Antibody (Center) [APR14979G]

Sign In for Pricing
View Details