Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAF6 Rabbit Polyclonal Antibody (HRP)

TAF6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ALYUS, TAF2E, TAFII70, TAFII80, TAFII85, MGC:8964, TAFII-70, TAFII-80, TAF (II) 70, TAF (II) 80

UniProt

P49848

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TAF6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMG

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005632

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAM28 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F4]
TA812739AM 100 µL

ADAM28 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F4]

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2956), CF594 conjugate, 0.1mg/mL
BNC942956-500 1x 500 µL

C1QA / Complement C1q A-Chain (C1QA/2956), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GATD3 (NM_198155) Human Over-expression Lysate
LY403674 100 µg

GATD3 (NM_198155) Human Over-expression Lysate

Sign In for Pricing
View Details
RABEP2 Antibody
8C18116-AAT 50 µg

RABEP2 Antibody

Sign In for Pricing
View Details
Rnf150 Mouse Gene Knockout Kit (CRISPR)
KN514914 1 Kit

Rnf150 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Alpha A Crystallin Antibody
KC-17722-01 50 μL

Alpha A Crystallin Antibody

Sign In for Pricing
View Details