Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAF6 Rabbit Polyclonal Antibody (HRP)

TAF6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ALYUS, TAF2E, TAFII70, TAFII80, TAFII85, MGC:8964, TAFII-70, TAFII-80, TAF (II) 70, TAF (II) 80

UniProt

P49848

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TAF6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PSVQPIVKLVSTATTAPPSTAPSGPGSVQKYIVVSLPPTGEGKGGPTSHP

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

ChIP, WB

NCBI Accession Number

NP_005632

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Arabidopsis thaliana GDP-Man:Man (3) GlcNAc (2) -PP-Dol alpha-1,2-mannosyltransferase (ALG11)
orb2924609-01 20 µg

Recombinant Arabidopsis thaliana GDP-Man:Man (3) GlcNAc (2) -PP-Dol alpha-1,2-mannosyltransferase (ALG11)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana GDP-Man:Man (3) GlcNAc (2) -PP-Dol alpha-1,2-mannosyltransferase (ALG11)
orb2924609-02 100 µg

Recombinant Arabidopsis thaliana GDP-Man:Man (3) GlcNAc (2) -PP-Dol alpha-1,2-mannosyltransferase (ALG11)

Sign In for Pricing
View Details
PLC γ2 Rabbit Polyclonal Antibody
APRab16249-01 20 µL

PLC γ2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PLC γ2 Rabbit Polyclonal Antibody
APRab16249-02 50 µL

PLC γ2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PLC γ2 Rabbit Polyclonal Antibody
APRab16249-03 100 µL

PLC γ2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PLC γ2 Rabbit Polyclonal Antibody
APRab16249-04 200 µL

PLC γ2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details