Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pura Rabbit Polyclonal Antibody (HRP)

Pura Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Pur, ssCR, CAGER, CAGER-1, ssCRE-BP, Pur-alpha, 6330411E07R, 6330411E07Rik

UniProt

P42669

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KPTYRNSITVPYKVWAKFGHTFCKYSEEMKKIQEKQREKRAACEQLHQQQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_033015

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal HLA DQ Antibody (HLA-DQA1/2866R) [mFluor Violet 610 SE]
NBP3-08747MFV610 0.1 mL

Rabbit Monoclonal HLA DQ Antibody (HLA-DQA1/2866R) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Rat Cell Surface Glycoprotein MUC18, MCAM GENLISA ELISA
KLR1669 96 Well

Rat Cell Surface Glycoprotein MUC18, MCAM GENLISA ELISA

Sign In for Pricing
View Details
Anti-AIF/AIFM1 Antibody Picoband® (Biotine Conjugate)
PB9366-Biotin 100 µg/Vial

Anti-AIF/AIFM1 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
ENPP2 Rabbit Polyclonal Antibody (BF700)
orb2401906 100 µL

ENPP2 Rabbit Polyclonal Antibody (BF700)

Sign In for Pricing
View Details
Rat Elavl1 / ELAV-like protein 1 Recombinant Protein
R14266r 1 Each

Rat Elavl1 / ELAV-like protein 1 Recombinant Protein

Sign In for Pricing
View Details
Maltose Binding Protein / MBP-probe (R29.6), Biotin conjugate, 0.1mg/mL
BNCB2847-100 1x 100 µL

Maltose Binding Protein / MBP-probe (R29.6), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details