Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pura Rabbit Polyclonal Antibody (HRP)

Pura Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Pur, ssCR, CAGER, CAGER-1, ssCRE-BP, Pur-alpha, 6330411E07R, 6330411E07Rik

UniProt

P42669

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KPTYRNSITVPYKVWAKFGHTFCKYSEEMKKIQEKQREKRAACEQLHQQQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_033015

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella Boydii pepE Protein (aa 1-229)
VAng-Lsx08750-50gEcoli 50 µg (E. coli)

Recombinant Shigella Boydii pepE Protein (aa 1-229)

Sign In for Pricing
View Details
Guanine Nucleotide-Binding Protein Subunit Alpha-13 (GNA13) Antibody
abx215490 100 µg

Guanine Nucleotide-Binding Protein Subunit Alpha-13 (GNA13) Antibody

Sign In for Pricing
View Details
PCNA Mouse Monoclonal Antibody (7D1)
E12-811 100 µg -100 µL

PCNA Mouse Monoclonal Antibody (7D1)

Sign In for Pricing
View Details
PKDREJ CRISPR Activation Plasmid (h2)
sc-411459-ACT-2 20 µg

PKDREJ CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
CD90 (Thymus Cell Antigen 1, theta, T25, Thy-1, Thy1.1, Thy1.2, Thy 1.2, Thy-1.2, Thy-1 antigen, Thy-1 membrane glycoprotein) (APC) discontinued
C2441-APC 100 µL

CD90 (Thymus Cell Antigen 1, theta, T25, Thy-1, Thy1.1, Thy1.2, Thy 1.2, Thy-1.2, Thy-1 antigen, Thy-1 membrane glycoprotein) (APC) discontinued

Sign In for Pricing
View Details
LOXL3 Rabbit Polyclonal Antibody (BF405)
orb2481069 100 µL

LOXL3 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details