Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMAD1 Rabbit Polyclonal Antibody (HRP)

SMAD1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BSP1, JV41, BSP-1, JV4-1, MADH1, MADR1

UniProt

Q99717

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SMAD1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEE

Field of Research

Neuroscience

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_005891

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DGKZ, CT (DGKZ, DAGK6, Diacylglycerol kinase zeta, Diglyceride kinase zeta) (Azide free) (HRP) discontinued
034605-HRP 200 µL

DGKZ, CT (DGKZ, DAGK6, Diacylglycerol kinase zeta, Diglyceride kinase zeta) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Galectin 2 (GAL2)
MBS2040756-01 0.1 mL

PE-Linked Monoclonal Antibody to Galectin 2 (GAL2)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Galectin 2 (GAL2)
MBS2040756-02 0.2 mL

PE-Linked Monoclonal Antibody to Galectin 2 (GAL2)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Galectin 2 (GAL2)
MBS2040756-03 0.5 mL

PE-Linked Monoclonal Antibody to Galectin 2 (GAL2)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Galectin 2 (GAL2)
MBS2040756-04 1 mL

PE-Linked Monoclonal Antibody to Galectin 2 (GAL2)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Galectin 2 (GAL2)
MBS2040756-05 5 mL

PE-Linked Monoclonal Antibody to Galectin 2 (GAL2)

Sign In for Pricing
View Details