Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMAD2 Rabbit Polyclonal Antibody (HRP)

SMAD2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

JV18, MADH2, MADR2, JV18-1, hMAD-2, hSMAD2

UniProt

Q15796

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SMAD2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLD

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005892

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Fibulin 4 ELISA Kit
MBS091818-01 48 Well

Mouse Fibulin 4 ELISA Kit

Sign In for Pricing
View Details
Mouse Fibulin 4 ELISA Kit
MBS091818-02 96 Well

Mouse Fibulin 4 ELISA Kit

Sign In for Pricing
View Details
Mouse Fibulin 4 ELISA Kit
MBS091818-03 5x 96 Well

Mouse Fibulin 4 ELISA Kit

Sign In for Pricing
View Details
Mouse Fibulin 4 ELISA Kit
MBS091818-04 10x 96 Well

Mouse Fibulin 4 ELISA Kit

Sign In for Pricing
View Details
Anti-Human Epididymis Protein 4 Antibody
10-8014 1 mg

Anti-Human Epididymis Protein 4 Antibody

Sign In for Pricing
View Details
Anti-SENP6 Picoband® Antibody, Carrier-free
A05088-3-carrier-free 100 µg/Vial

Anti-SENP6 Picoband® Antibody, Carrier-free

Sign In for Pricing
View Details