Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEF2D Rabbit Polyclonal Antibody (HRP)

MEF2D Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DKFZp686I1536

UniProt

Q14814

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MEF2D

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GDGLSSPAGGSYETGDRDDGRGDFGPTLGLLRPAPEPEAEGSAVKRMRLD

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005911

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATRIP Rabbit Polyclonal Antibody (Fluoro647)
orb3106912 100 µg

ATRIP Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Rabbit IgG Affinity Agarose
EA-IP-200 2 mL

Rabbit IgG Affinity Agarose

Sign In for Pricing
View Details
SUPER-X PLEX ® Human Midkine Flow Cytometry Assay - Group 10
HX87371 96 Tests

SUPER-X PLEX ® Human Midkine Flow Cytometry Assay - Group 10

Sign In for Pricing
View Details
General Transcription Factor IIF Polypeptide 1 (GTF2F1) Rabbit ELISA Kit
D8829 96 Tests

General Transcription Factor IIF Polypeptide 1 (GTF2F1) Rabbit ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Fis1 shRNA (UAS) - Lentiviral mouse Fis1 shRNA (UAS, RFP) (100)
GTR15258888 1 Vial

Lentiviral mouse Fis1 shRNA (UAS) - Lentiviral mouse Fis1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Sartorius Filter Paper G288 240mm
SAR2093 100 / PCK

Sartorius Filter Paper G288 240mm

Sign In for Pricing
View Details