Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEOX2 Rabbit Polyclonal Antibody (HRP)

MEOX2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GAX, MOX2

UniProt

P50222

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MEOX2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MEHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCII

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005915

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXN2, NT (FOXN2, HTLF, Forkhead box protein N2, Human T-cell leukemia virus enhancer factor) (PE) discontinued
035745-PE 200 µL

FOXN2, NT (FOXN2, HTLF, Forkhead box protein N2, Human T-cell leukemia virus enhancer factor) (PE) discontinued

Sign In for Pricing
View Details
PRPSAP1 siRNA (Human)
CRH3798-01 15 nmol

PRPSAP1 siRNA (Human)

Sign In for Pricing
View Details
PRPSAP1 siRNA (Human)
CRH3798-02 30 nmol

PRPSAP1 siRNA (Human)

Sign In for Pricing
View Details
MAGEA3 (Melanoma Antigen Family A, 3, HIP8, HYPD, MAGE3, MAGEA6, MGC14613) (MaxLight 405) discontinued
248390-ML405 100 µL

MAGEA3 (Melanoma Antigen Family A, 3, HIP8, HYPD, MAGE3, MAGEA6, MGC14613) (MaxLight 405) discontinued

Sign In for Pricing
View Details
RN5S519 Protein Vector (Human) (pPM-C-His)
PV117789 500 ng

RN5S519 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
GIMAP6 Rabbit Polyclonal Antibody
orb1562601 100 µg

GIMAP6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details