Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAB1 Rabbit Polyclonal Antibody (Biotin)

NAB1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q13506

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human NAB1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VVDGELSRLYPSEAKSHSSESLGILKDYPHSAFTLEKKVIKTEPEDSR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005957

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat nuclear factor-κB p65,NF-κB p66 ELISA Kit
CN-01728R2 48T

Rat nuclear factor-κB p65,NF-κB p66 ELISA Kit

Sign In for Pricing
View Details
genesig Std Real-time PCR detection kit, Leishmania species
Z-Path-Leishmania-std 150 Tests

genesig Std Real-time PCR detection kit, Leishmania species

Sign In for Pricing
View Details
Donkey Peptide Major Histocompatibility Complex (PMHC) ELISA Kit
MBS9939797 Inquire

Donkey Peptide Major Histocompatibility Complex (PMHC) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Zbtb9 shRNA (UAS) - Lentiviral mouse Zbtb9 shRNA (UAS, iRFP) (25)
GTR15225626 1 Vial

Lentiviral mouse Zbtb9 shRNA (UAS) - Lentiviral mouse Zbtb9 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
RT1-CE15 3'UTR Luciferase Stable Cell Line
TU219780 1.0 mL

RT1-CE15 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
RASSF2 Antibody
E38PA2421 100 µL

RASSF2 Antibody

Sign In for Pricing
View Details