Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAB2 Rabbit Polyclonal Antibody (HRP)

NAB2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MADER

UniProt

Q15742

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NAB2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MHRAPSPTAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQ

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005958

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rno-miR-181c-5p miRNA Antagomir
MBS8320559-01 10 nmol

rno-miR-181c-5p miRNA Antagomir

Sign In for Pricing
View Details
rno-miR-181c-5p miRNA Antagomir
MBS8320559-02 20 nmol

rno-miR-181c-5p miRNA Antagomir

Sign In for Pricing
View Details
rno-miR-181c-5p miRNA Antagomir
MBS8320559-03 5x 20 nmol

rno-miR-181c-5p miRNA Antagomir

Sign In for Pricing
View Details
Mouse Gda qPCR Primer Pair
QM13658S 200 Tests

Mouse Gda qPCR Primer Pair

Sign In for Pricing
View Details
Elab Fluor® 488 Goat Anti-Rat IgG (H+L) Antibody[Poly1441]
AN00339L-01 50 Tests

Elab Fluor® 488 Goat Anti-Rat IgG (H+L) Antibody[Poly1441]

Sign In for Pricing
View Details
Elab Fluor® 488 Goat Anti-Rat IgG (H+L) Antibody[Poly1441]
AN00339L-02 100 Tests

Elab Fluor® 488 Goat Anti-Rat IgG (H+L) Antibody[Poly1441]

Sign In for Pricing
View Details