Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAB2 Rabbit Polyclonal Antibody (Biotin)

NAB2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MADER

UniProt

Q15742

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human NAB2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GRLSPCVPAKPPLAEFEEGLLDRCPAPGPHPALVEGRRSSVKVEAEASRQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005958

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DYNC1LI2, ID (DYNC1LI2, DNCLI2, LIC2, Cytoplasmic dynein 1 light intermediate chain 2, Dynein light intermediate chain 2, cytosolic, LIC53/55) (MaxLight 490) discontinued
034873-ML490 100 µL

DYNC1LI2, ID (DYNC1LI2, DNCLI2, LIC2, Cytoplasmic dynein 1 light intermediate chain 2, Dynein light intermediate chain 2, cytosolic, LIC53/55) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Buxifoliadine H
HY-N13685 1 Each

Buxifoliadine H

Sign In for Pricing
View Details
Human Ubiquitin carboxyl-terminal hydrolase 46, USP46 ELISA KIT
ELI-17873h 96 Tests

Human Ubiquitin carboxyl-terminal hydrolase 46, USP46 ELISA KIT

Sign In for Pricing
View Details
Lysyl tRNA synthetase Recombinant Antibody, Biotin Conjugated
bsm-61951R-Biotin-TR 20 µL

Lysyl tRNA synthetase Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Recombinant Vibrio Cholerae pepT Protein (aa 1-410) (strain ATCC 39541 / Ogawa 395 / O395)
VAng-Cr3147-500gEcoli 500 µg (E. coli)

Recombinant Vibrio Cholerae pepT Protein (aa 1-410) (strain ATCC 39541 / Ogawa 395 / O395)

Sign In for Pricing
View Details
B3gat2 Rabbit Polyclonal Antibody (Biotin)
orb2111911 100 µL

B3gat2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details