Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOX1 Rabbit Polyclonal Antibody (HRP)

SOX1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

O00570

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SOX1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GGGAKANQDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005977

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-YY1 Antibody Picoband® (monoclonal, 2C10F9) (Biotine Conjugate)
M00833-2-Biotin 100 µg/Vial

Anti-YY1 Antibody Picoband® (monoclonal, 2C10F9) (Biotine Conjugate)

Sign In for Pricing
View Details
VGF Blocking Peptide
33R-1490 0.1 mg

VGF Blocking Peptide

Sign In for Pricing
View Details
ZNF784 (B-8) Alexa Fluor® 790
sc-514381 AF790 200 µg/mL

ZNF784 (B-8) Alexa Fluor® 790

Sign In for Pricing
View Details
KCNT1 Rabbit Polyclonal Antibody (Biotin)
orb452679 100 µL

KCNT1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
LENG8 Protein Vector (Human) (pPM-C-His)
PV023576 500 ng

LENG8 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Lentiviral human PPFIA3 shRNA (UAS) - Lentiviral human PPFIA3 shRNA (UAS, iRFP) (25)
GTR15323861 1 Vial

Lentiviral human PPFIA3 shRNA (UAS) - Lentiviral human PPFIA3 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details