Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOX1 Rabbit Polyclonal Antibody (HRP)

SOX1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

O00570

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SOX1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GGGAKANQDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005977

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BARX1 (Prognostic Biomarker in Hepatocellular Carcinoma) (BARX1/2759), CF640R conjugate, 0.1mg/mL
BNC402759-500 1x 500 µL

BARX1 (Prognostic Biomarker in Hepatocellular Carcinoma) (BARX1/2759), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nucleophosmin (Acute Myeloid Leukemia Marker) (NPM1/1902), CF405S conjugate, 0.1mg/mL
BNC041902-500 1x 500 µL

Nucleophosmin (Acute Myeloid Leukemia Marker) (NPM1/1902), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pre and Post Vacuum Class B Autoclave BAPV-501
BAPV-501 1 Unit

Pre and Post Vacuum Class B Autoclave BAPV-501

Sign In for Pricing
View Details
Recombinant Rat AIF-M1 protein (His tag)
PDER100205-01 20 µg

Recombinant Rat AIF-M1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat AIF-M1 protein (His tag)
PDER100205-02 100 µg

Recombinant Rat AIF-M1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat AIF-M1 protein (His tag)
PDER100205-03 500 µg

Recombinant Rat AIF-M1 protein (His tag)

Sign In for Pricing
View Details