Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSC22D1 Rabbit Polyclonal Antibody (HRP)

TSC22D1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ptg-2, TSC22, TGFB1I4

UniProt

Q15714

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TSC22D1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKEL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006013

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV3-U6-Slc31a1-shRNA5-CopGFP-Puro Plasmid
PVT76647 2 µg

PLV3-U6-Slc31a1-shRNA5-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
Recombinant Vibrio vulnificus Chromosome partition protein mukF (mukF)
MBS1386607-01 0.02 mg (E-Coli)

Recombinant Vibrio vulnificus Chromosome partition protein mukF (mukF)

Sign In for Pricing
View Details
Recombinant Vibrio vulnificus Chromosome partition protein mukF (mukF)
MBS1386607-02 0.02 mg (Yeast)

Recombinant Vibrio vulnificus Chromosome partition protein mukF (mukF)

Sign In for Pricing
View Details
Recombinant Vibrio vulnificus Chromosome partition protein mukF (mukF)
MBS1386607-03 0.1 mg (E-Coli)

Recombinant Vibrio vulnificus Chromosome partition protein mukF (mukF)

Sign In for Pricing
View Details
Recombinant Vibrio vulnificus Chromosome partition protein mukF (mukF)
MBS1386607-04 0.1 mg (Yeast)

Recombinant Vibrio vulnificus Chromosome partition protein mukF (mukF)

Sign In for Pricing
View Details
Recombinant Vibrio vulnificus Chromosome partition protein mukF (mukF)
MBS1386607-05 0.02 mg (Baculovirus)

Recombinant Vibrio vulnificus Chromosome partition protein mukF (mukF)

Sign In for Pricing
View Details