Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hdac6 Rabbit Polyclonal Antibody (Biotin)

Hdac6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Hd6, Sfc, Sfc6, mHDA, Hdac5, mHDA2

UniProt

Q9Z2V5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Hdac6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VCHHEASEHPLVLSCVDLSTWCYVCQAYVHHEDLQDVKNAAHQNKFGEDM

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

126kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

ChIP, IHC, WB

NCBI Accession Number

NP_034543

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nupl1 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K5003503 1.0 µg DNA

Nupl1 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
CNDP1 (CN1, CPGL2, Beta-Ala-His Dipeptidase, CNDP Dipeptidase 1, Carnosine Dipeptidase 1, Glutamate Carboxypeptidase-like Protein 2, Serum Carnosinase, UNQ1915/PRO4380, MGC102737, MGC10825, MGC142072) (Biotin)
MBS6374227-01 0.1 mL

CNDP1 (CN1, CPGL2, Beta-Ala-His Dipeptidase, CNDP Dipeptidase 1, Carnosine Dipeptidase 1, Glutamate Carboxypeptidase-like Protein 2, Serum Carnosinase, UNQ1915/PRO4380, MGC102737, MGC10825, MGC142072) (Biotin)

Sign In for Pricing
View Details
CNDP1 (CN1, CPGL2, Beta-Ala-His Dipeptidase, CNDP Dipeptidase 1, Carnosine Dipeptidase 1, Glutamate Carboxypeptidase-like Protein 2, Serum Carnosinase, UNQ1915/PRO4380, MGC102737, MGC10825, MGC142072) (Biotin)
MBS6374227-02 5x 0.1 mL

CNDP1 (CN1, CPGL2, Beta-Ala-His Dipeptidase, CNDP Dipeptidase 1, Carnosine Dipeptidase 1, Glutamate Carboxypeptidase-like Protein 2, Serum Carnosinase, UNQ1915/PRO4380, MGC102737, MGC10825, MGC142072) (Biotin)

Sign In for Pricing
View Details
Phospholipid Scramblase 1 (PLSCR1) Rabbit mAb (AMR11915N)
AMR11915N-01 50 µL

Phospholipid Scramblase 1 (PLSCR1) Rabbit mAb (AMR11915N)

Sign In for Pricing
View Details
Phospholipid Scramblase 1 (PLSCR1) Rabbit mAb (AMR11915N)
AMR11915N-02 100 µL

Phospholipid Scramblase 1 (PLSCR1) Rabbit mAb (AMR11915N)

Sign In for Pricing
View Details
Phospholipid Scramblase 1 (PLSCR1) Rabbit mAb (AMR11915N)
AMR11915N-03 200 µL

Phospholipid Scramblase 1 (PLSCR1) Rabbit mAb (AMR11915N)

Sign In for Pricing
View Details