Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFE2L2 Rabbit Polyclonal Antibody (HRP)

NFE2L2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NRF2, HEBP1, Nrf-2, IMDDHH

UniProt

Q16236

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence DIDLGVSREVFDFSQRRKEYELEKQKKLEKERQEQLQKEQEKAFFAQLQL

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DIDLGVSREVFDFSQRRKEYELEKQKKLEKERQEQLQKEQEKAFFAQLQL

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

68 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat

NCBI Accession Number

NP_006155

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mitochondrial enolase superfamily member 1 (ENOSF1) Bovine ELISA Kit
F0227 96 Tests

Mitochondrial enolase superfamily member 1 (ENOSF1) Bovine ELISA Kit

Sign In for Pricing
View Details
Mouse EpCAM Protein, His Tag
orb257433-01 100 µg

Mouse EpCAM Protein, His Tag

Sign In for Pricing
View Details
Mouse EpCAM Protein, His Tag
orb257433-02 1 mg

Mouse EpCAM Protein, His Tag

Sign In for Pricing
View Details
CD38 (ADP Ribosyl Cyclase I) Recombinant Rabbit Monoclonal Antibody [Clone CD38/4247R]
MBS4382403-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

CD38 (ADP Ribosyl Cyclase I) Recombinant Rabbit Monoclonal Antibody [Clone CD38/4247R]

Sign In for Pricing
View Details
CD38 (ADP Ribosyl Cyclase I) Recombinant Rabbit Monoclonal Antibody [Clone CD38/4247R]
MBS4382403-02 0.1 mg (With BSA & Azide at 0.2mg/mL)

CD38 (ADP Ribosyl Cyclase I) Recombinant Rabbit Monoclonal Antibody [Clone CD38/4247R]

Sign In for Pricing
View Details
CD38 (ADP Ribosyl Cyclase I) Recombinant Rabbit Monoclonal Antibody [Clone CD38/4247R]
MBS4382403-03 0.1 mg (Without BSA & Azide at 1mg/mL)

CD38 (ADP Ribosyl Cyclase I) Recombinant Rabbit Monoclonal Antibody [Clone CD38/4247R]

Sign In for Pricing
View Details