Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPF2 Rabbit Polyclonal Antibody (FITC)

DPF2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

REQ, CSS7, UBID4, ubi-d4

UniProt

Q92785

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DPF2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQ

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006259

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEDD5/septin 2 Recombinant Antibody, Cy5 Conjugated
bsm-61872R-Cy5-01 20 µL

NEDD5/septin 2 Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
NEDD5/septin 2 Recombinant Antibody, Cy5 Conjugated
bsm-61872R-Cy5-02 100 µL

NEDD5/septin 2 Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Recombinant Intercellular Adhesion Molecule 5 (ICAM5)
SIPA528Rb01-01 10 µg

Recombinant Intercellular Adhesion Molecule 5 (ICAM5)

Sign In for Pricing
View Details
Recombinant Intercellular Adhesion Molecule 5 (ICAM5)
SIPA528Rb01-02 50 µg

Recombinant Intercellular Adhesion Molecule 5 (ICAM5)

Sign In for Pricing
View Details
Recombinant Intercellular Adhesion Molecule 5 (ICAM5)
SIPA528Rb01-03 200 µg

Recombinant Intercellular Adhesion Molecule 5 (ICAM5)

Sign In for Pricing
View Details
Recombinant Intercellular Adhesion Molecule 5 (ICAM5)
SIPA528Rb01-04 1 mg

Recombinant Intercellular Adhesion Molecule 5 (ICAM5)

Sign In for Pricing
View Details