Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPF2 Rabbit Polyclonal Antibody (FITC)

DPF2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

REQ, CSS7, UBID4, ubi-d4

UniProt

Q92785

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DPF2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQNQNS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006259

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCN8A (Sodium Channel Protein Type 8 Subunit alpha, Sodium Channel Protein Type VIII Subunit alpha, Voltage-gated Sodium Channel Subunit alpha, Nav1.6, MED) discontinued
361144-01 50 µL

SCN8A (Sodium Channel Protein Type 8 Subunit alpha, Sodium Channel Protein Type VIII Subunit alpha, Voltage-gated Sodium Channel Subunit alpha, Nav1.6, MED) discontinued

Sign In for Pricing
View Details
SCN8A (Sodium Channel Protein Type 8 Subunit alpha, Sodium Channel Protein Type VIII Subunit alpha, Voltage-gated Sodium Channel Subunit alpha, Nav1.6, MED) discontinued
361144-02 100 µL

SCN8A (Sodium Channel Protein Type 8 Subunit alpha, Sodium Channel Protein Type VIII Subunit alpha, Voltage-gated Sodium Channel Subunit alpha, Nav1.6, MED) discontinued

Sign In for Pricing
View Details
Caspase 8/CASP8 Rabbit Polyclonal Antibody (Biotin)
orb2612696 100 µg

Caspase 8/CASP8 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
1-[ (1-Methyl-1H-pyrazol-4-yl) methyl]piperidine-4-carboxylic acid
GQB48365-01 50 mg

1-[ (1-Methyl-1H-pyrazol-4-yl) methyl]piperidine-4-carboxylic acid

Sign In for Pricing
View Details
1-[ (1-Methyl-1H-pyrazol-4-yl) methyl]piperidine-4-carboxylic acid
GQB48365-02 0.5 g

1-[ (1-Methyl-1H-pyrazol-4-yl) methyl]piperidine-4-carboxylic acid

Sign In for Pricing
View Details
AP-2gamma Antibody
MBS859693-01 0.2 mL

AP-2gamma Antibody

Sign In for Pricing
View Details