Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPF2 Rabbit Polyclonal Antibody (HRP)

DPF2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

REQ, CSS7, UBID4, ubi-d4

UniProt

Q92785

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DPF2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQNQNS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006259

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cplx3 Rat shRNA Plasmid (Locus ID 501005)
TL707797 1 Kit

Cplx3 Rat shRNA Plasmid (Locus ID 501005)

Sign In for Pricing
View Details
E3 ubiquitin-protein ligase HUWE1
AP83990 1 mg

E3 ubiquitin-protein ligase HUWE1

Sign In for Pricing
View Details
ETO-2 Double Nickase Plasmid (m2)
sc-419486-NIC-2 20 µg

ETO-2 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Anti-Mouse TCR α Antibody (H28-710), APC
MP957137-01 1 Each

Anti-Mouse TCR α Antibody (H28-710), APC

Sign In for Pricing
View Details
Anti-Mouse TCR α Antibody (H28-710), APC
MP957137-02 100 Tests

Anti-Mouse TCR α Antibody (H28-710), APC

Sign In for Pricing
View Details
PAN2 Adenovirus (Mouse)
35976054 1.0 mL

PAN2 Adenovirus (Mouse)

Sign In for Pricing
View Details