Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSG101 Rabbit Polyclonal Antibody (Biotin)

TSG101 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

TSG10, VPS23

UniProt

Q99816

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TSG101

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006283

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-17C ELISA Kit
MBS8244654-01 96 Tests

Human IL-17C ELISA Kit

Sign In for Pricing
View Details
Human IL-17C ELISA Kit
MBS8244654-02 5x 96 Tests

Human IL-17C ELISA Kit

Sign In for Pricing
View Details
MSL1, ID (MSL1, MSL1L1, Male-specific lethal 1 homolog, Male-specific lethal 1-like 1, Male-specific lethal-1 homolog 1) (MaxLight 650) discontinued
038633-ML650 100 µL

MSL1, ID (MSL1, MSL1L1, Male-specific lethal 1 homolog, Male-specific lethal 1-like 1, Male-specific lethal-1 homolog 1) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Junctional Adhesion Molecule 1 (JAM 1, JAM-1, JAM1, CD321, F11 Receptor, F11R, Junctional Adhesion Molecule A, JAMA, JCAM, KAT, Platelet Adhesion Molecule 1, PAM1, Platelet F11 Receptor, UNQ264/PRO301) (APC)
MBS6268934-01 0.1 mL

Junctional Adhesion Molecule 1 (JAM 1, JAM-1, JAM1, CD321, F11 Receptor, F11R, Junctional Adhesion Molecule A, JAMA, JCAM, KAT, Platelet Adhesion Molecule 1, PAM1, Platelet F11 Receptor, UNQ264/PRO301) (APC)

Sign In for Pricing
View Details
Junctional Adhesion Molecule 1 (JAM 1, JAM-1, JAM1, CD321, F11 Receptor, F11R, Junctional Adhesion Molecule A, JAMA, JCAM, KAT, Platelet Adhesion Molecule 1, PAM1, Platelet F11 Receptor, UNQ264/PRO301) (APC)
MBS6268934-02 5x 0.1 mL

Junctional Adhesion Molecule 1 (JAM 1, JAM-1, JAM1, CD321, F11 Receptor, F11R, Junctional Adhesion Molecule A, JAMA, JCAM, KAT, Platelet Adhesion Molecule 1, PAM1, Platelet F11 Receptor, UNQ264/PRO301) (APC)

Sign In for Pricing
View Details
Lentiviral mouse Mamld1 shRNA (UAS) - Lentiviral mouse Mamld1 shRNA (UAS, GFP) (100)
GTR15221529 1 Vial

Lentiviral mouse Mamld1 shRNA (UAS) - Lentiviral mouse Mamld1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details