Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSG101 Rabbit Polyclonal Antibody (FITC)

TSG101 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TSG10, VPS23

UniProt

Q99816

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TSG101

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006283

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FBLN2 (Fibulin 2) ELISA Kit
RE1975H-01 48 Tests

Human FBLN2 (Fibulin 2) ELISA Kit

Sign In for Pricing
View Details
Human FBLN2 (Fibulin 2) ELISA Kit
RE1975H-02 96 Tests

Human FBLN2 (Fibulin 2) ELISA Kit

Sign In for Pricing
View Details
Bovine Small nuclear ribonucleoprotein G, SNRPG ELISA KIT
ELI-42249b 96 Tests

Bovine Small nuclear ribonucleoprotein G, SNRPG ELISA KIT

Sign In for Pricing
View Details
Hypoxia-Inducible Factor 1-Alpha Inhibitor (FIH) Antibody (ATTO 488)
abx440342 100 µg

Hypoxia-Inducible Factor 1-Alpha Inhibitor (FIH) Antibody (ATTO 488)

Sign In for Pricing
View Details
inhA Antibody, Biotin conjugated
A51716-50UG 50 µg

inhA Antibody, Biotin conjugated

Sign In for Pricing
View Details
Stanniocalcin-2 (STC2) Guinea Pig ELISA Kit
H3081 96 Tests

Stanniocalcin-2 (STC2) Guinea Pig ELISA Kit

Sign In for Pricing
View Details