Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMC1A Rabbit Polyclonal Antibody (Biotin)

SMC1A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SMC1, SMCB, CDLS2, DEE85, SB1.8, EIEE85, SMC1L1, DXS423E, SMC1alpha

UniProt

Q14683

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SMC1A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VISLKEEFYTKAESLIGVYPEQGDCVISKVLTFDLTKYPDANPNPNEQ

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

143kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_006297

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Akt2 Mouse Pre-designed siRNA Set A
HY-RS00547 1 Set

Akt2 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
AI316807 Protein Vector (Mouse) (pPB-C-His)
PV153258 500 ng

AI316807 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Lentiviral human SHQ1 sgRNA gene knockout kit - Lentiviral human SHQ1 sgRNA gene knockout kit (25)
GTR15362859 1 Vial

Lentiviral human SHQ1 sgRNA gene knockout kit - Lentiviral human SHQ1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Mouse Taar4 Pre-designed siRNA Set B
SI114180B 1 Each

Mouse Taar4 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Lentiviral mouse Rrm2b shRNA (UAS) - Lentiviral mouse Rrm2b shRNA (UAS, iRFP) (25)
GTR15117446 1 Vial

Lentiviral mouse Rrm2b shRNA (UAS) - Lentiviral mouse Rrm2b shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
N-Caproicacid-d11 (sodium)
HY-W099696S 1 mg

N-Caproicacid-d11 (sodium)

Sign In for Pricing
View Details