Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hmg20b Rabbit Polyclonal Antibody (HRP)

Hmg20b Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

D4A586

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TKMLGAEWSKLQPAEKQRYLDEAEKEKQQYLKELWAYQQSEAYKVCTEKI

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001102201

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRMD7, NT (FRMD7, FERM domain-containing protein 7) (APC)
MBS6300148-01 0.2 mL

FRMD7, NT (FRMD7, FERM domain-containing protein 7) (APC)

Sign In for Pricing
View Details
FRMD7, NT (FRMD7, FERM domain-containing protein 7) (APC)
MBS6300148-02 5x 0.2 mL

FRMD7, NT (FRMD7, FERM domain-containing protein 7) (APC)

Sign In for Pricing
View Details
Lentiviral mouse Pqlc2 shRNA (UAS) - Lentiviral mouse Pqlc2 shRNA (UAS) (100)
GTR15186498 1 Vial

Lentiviral mouse Pqlc2 shRNA (UAS) - Lentiviral mouse Pqlc2 shRNA (UAS) (100)

Sign In for Pricing
View Details
PIC M018-Dia 100-PE-ROLL/1 Personal Protection (PPE) Signs & Labels (Adhesive)
820505 250 Roll (250 Panel (s) x 1 Roll)

PIC M018-Dia 100-PE-ROLL/1 Personal Protection (PPE) Signs & Labels (Adhesive)

Sign In for Pricing
View Details
CLEC4F, CT (CLEC4F, CLECSF13, C-type lectin domain family 4 member F, C-type lectin superfamily member 13) (MaxLight 750)
MBS6286710-01 0.1 mL

CLEC4F, CT (CLEC4F, CLECSF13, C-type lectin domain family 4 member F, C-type lectin superfamily member 13) (MaxLight 750)

Sign In for Pricing
View Details
CLEC4F, CT (CLEC4F, CLECSF13, C-type lectin domain family 4 member F, C-type lectin superfamily member 13) (MaxLight 750)
MBS6286710-02 5x 0.1 mL

CLEC4F, CT (CLEC4F, CLECSF13, C-type lectin domain family 4 member F, C-type lectin superfamily member 13) (MaxLight 750)

Sign In for Pricing
View Details