Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FXN, Mouse (His)

FXN protein is a key activator in the core iron-sulfur cluster (ISC) assembly complex, accelerating persulfide transfer to ISCU and [2Fe-2S] cluster assembly. It promotes sulfur transfer, leading to oversulfidation and sulfide release. FXN Protein, Mouse (His) is the recombinant mouse-derived FXN protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FXN Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fxn-protein-mouse-his.html

Smiles

LGTLDNPSSLDETAYERLAEETLDSLAEFFEDLADKPYTLEDYDVSFGDGVLTIKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLARELTKALNTKLDLSSLAYSGKGT

Molecular Formula

14297 (Gene_ID) O35943 (L78-T207) (Accession)

Molecular Weight

Approximately 19.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Altrakincept Monoclonal Antibody
orb2977308-01 100 µg

Altrakincept Monoclonal Antibody

Sign In for Pricing
View Details
Altrakincept Monoclonal Antibody
orb2977308-02 1 mg

Altrakincept Monoclonal Antibody

Sign In for Pricing
View Details
NDUFAF4 Rabbit Monoclonal Antibody
E10G21722 100 µL

NDUFAF4 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SAA1 Rabbit pAb, AP conjugated
orb2839937 100 µL

SAA1 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
Human Complement C1s subcomponent, C1S ELISA KIT
ELI-50438h 96 Tests

Human Complement C1s subcomponent, C1S ELISA KIT

Sign In for Pricing
View Details
Recombinant Rhesus Macaque HMGA1 Protein, His (Fc)-Avi-tagged
HMGA1-1928R 50 µg

Recombinant Rhesus Macaque HMGA1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details