Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FXN, Mouse (His)

FXN protein is a key activator in the core iron-sulfur cluster (ISC) assembly complex, accelerating persulfide transfer to ISCU and [2Fe-2S] cluster assembly. It promotes sulfur transfer, leading to oversulfidation and sulfide release. FXN Protein, Mouse (His) is the recombinant mouse-derived FXN protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FXN Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fxn-protein-mouse-his.html

Smiles

LGTLDNPSSLDETAYERLAEETLDSLAEFFEDLADKPYTLEDYDVSFGDGVLTIKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLARELTKALNTKLDLSSLAYSGKGT

Molecular Formula

14297 (Gene_ID) O35943 (L78-T207) (Accession)

Molecular Weight

Approximately 19.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alexa Fluor® 647 anti-Lck
GT18916 100 µg

Alexa Fluor® 647 anti-Lck

Sign In for Pricing
View Details
Claudin 5 Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-61021R-BF647 100 µL

Claudin 5 Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Anti-Granzyme B Monoclonal Antibody
MBS1751947-01 0.03 mL

Anti-Granzyme B Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Granzyme B Monoclonal Antibody
MBS1751947-02 0.1 mL

Anti-Granzyme B Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Granzyme B Monoclonal Antibody
MBS1751947-03 5x 0.1 mL

Anti-Granzyme B Monoclonal Antibody

Sign In for Pricing
View Details
IL6 Antibody
orb1326130 100 µg

IL6 Antibody

Sign In for Pricing
View Details