Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM38 Rabbit Polyclonal Antibody (Biotin)

TRIM38 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RNF15, RORET

UniProt

O00635

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM38

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MASTTSTKKMMEEATCSICLSLMTNPVSINCGHSYCHLCITDFFKNPSQK

Field of Research

Immunology & Inflammation

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_006346

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS2P23 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2001307 1.0 µg DNA

RPS2P23 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
PIC 334-F-A2-B7541 AC Signs
808598 Card of 1 Pictogram(s)

PIC 334-F-A2-B7541 AC Signs

Sign In for Pricing
View Details
Human PPP2R5C/Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform ELISA Kit
MBS2907029-01 48 Well

Human PPP2R5C/Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform ELISA Kit

Sign In for Pricing
View Details
Human PPP2R5C/Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform ELISA Kit
MBS2907029-02 96 Well

Human PPP2R5C/Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform ELISA Kit

Sign In for Pricing
View Details
Human PPP2R5C/Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform ELISA Kit
MBS2907029-03 5x 96 Well

Human PPP2R5C/Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform ELISA Kit

Sign In for Pricing
View Details
Human PPP2R5C/Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform ELISA Kit
MBS2907029-04 10x 96 Well

Human PPP2R5C/Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform ELISA Kit

Sign In for Pricing
View Details