Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIC1 Rabbit Polyclonal Antibody (HRP)

HIC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Hic-1, ZBTB29, ZNF901

UniProt

Q14526

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HIC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GETPIAVMGEFANLATSLNPLDPDKDEEEEEEEESEDELPQDISLAAGGE

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_006488

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCAND1 Antibody
8C10759-AAT 50 µg

SCAND1 Antibody

Sign In for Pricing
View Details
Human KIAA1434 (GPCPD1) activation kit by CRISPRa
GA111170 1 Kit

Human KIAA1434 (GPCPD1) activation kit by CRISPRa

Sign In for Pricing
View Details
REEP4 Human Gene Knockout Kit (CRISPR)
KN402157 1 Kit

REEP4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD44v4 (Marker of Tumor Metastasis), CF740 conjugate, 0.1mg/mL
BNC741751-500 1x 500 µL

CD44v4 (Marker of Tumor Metastasis), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD98 Mouse Monoclonal Antibody [A9D7]
HA601125 100 µL

CD98 Mouse Monoclonal Antibody [A9D7]

Sign In for Pricing
View Details
Casp8ap2 Mouse Gene Knockout Kit (CRISPR)
KN502571 1 Kit

Casp8ap2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details