Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LBX1 Rabbit Polyclonal Antibody (HRP)

LBX1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HPX6, HPX-6, LBX1H, homeobox

UniProt

P52954

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LBX1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DHLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLLAAADKHAQGG

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_006553

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AIF1, NT (AIF1, G1, IBA1, Allograft inflammatory factor 1, Ionized calcium-binding adapter molecule 1, Protein G1)
031722 200 µL

AIF1, NT (AIF1, G1, IBA1, Allograft inflammatory factor 1, Ionized calcium-binding adapter molecule 1, Protein G1)

Sign In for Pricing
View Details
Kidney cancer tissue array, including pathology grade, TNM and clinical stage, 64 cases/ 64 cores
UKN641 64 Cases / 64 Cores

Kidney cancer tissue array, including pathology grade, TNM and clinical stage, 64 cases/ 64 cores

Sign In for Pricing
View Details
Slc39a13 Polyclonal Antibody, HRP Conjugated
A55644-100 100 µL

Slc39a13 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Itgb1bp2 Rat shRNA Plasmid (Locus ID 317258)
TL706784 1 Kit

Itgb1bp2 Rat shRNA Plasmid (Locus ID 317258)

Sign In for Pricing
View Details
Goat Polyclonal Proteasome subunit beta type 4 Antibody
NBP1-52080 0.1 mg

Goat Polyclonal Proteasome subunit beta type 4 Antibody

Sign In for Pricing
View Details
(rel) -AR234960 50mg
A24159-50 50 mg

(rel) -AR234960 50mg

Sign In for Pricing
View Details