Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTCF Rabbit Polyclonal Antibody (FITC)

CTCF Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MRD21, FAP108, CFAP108

UniProt

P49711

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CTCF

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEV

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

83kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

ChIP, WB

NCBI Accession Number

NP_006556

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-PLCG 2 (Tyr753) Rabbit Polyclonal Antibody (Cy5)
orb893355 100 µL

Phospho-PLCG 2 (Tyr753) Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Rhodopsin/RP4/RHO Rabbit Polyclonal Antibody (FITC)
orb463070 100 µL

Rhodopsin/RP4/RHO Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
4- (3-Isopropylureido) phenylboronic acid, pinacol ester
428893-01 100 mg

4- (3-Isopropylureido) phenylboronic acid, pinacol ester

Sign In for Pricing
View Details
4- (3-Isopropylureido) phenylboronic acid, pinacol ester
428893-02 250 mg

4- (3-Isopropylureido) phenylboronic acid, pinacol ester

Sign In for Pricing
View Details
AKT2, CT (AKT 2, Akt2, AKT2 Protein, AKT2_HUMAN, HIHGHH, Murine Thymoma Viral (V akt) Homolog 2, Murine Thymoma Viral (V-akt) Homolog-2, PKB, PKB beta, PKBB, PKBbeta, PRKBB, Protein Kinase Akt 2, Protein Kinase Akt-2, Protein Kinase B beta, RAC beta, RAC beta Serine Threonine Protein Kinase, RAC PK beta, Rac Protein Kinase beta, RAC-Beta, RAC-beta Serine/Threonine-protein Kinase, RAC-PK-beta, RACbeta, V Akt Murine Thymoma Viral Oncogene Homolog 2)
303107 100 µg

AKT2, CT (AKT 2, Akt2, AKT2 Protein, AKT2_HUMAN, HIHGHH, Murine Thymoma Viral (V akt) Homolog 2, Murine Thymoma Viral (V-akt) Homolog-2, PKB, PKB beta, PKBB, PKBbeta, PRKBB, Protein Kinase Akt 2, Protein Kinase Akt-2, Protein Kinase B beta, RAC beta, RAC beta Serine Threonine Protein Kinase, RAC PK beta, Rac Protein Kinase beta, RAC-Beta, RAC-beta Serine/Threonine-protein Kinase, RAC-PK-beta, RACbeta, V Akt Murine Thymoma Viral Oncogene Homolog 2)

Sign In for Pricing
View Details
XpressTM Human Claudin-1 Over-expressing Stable Cell Line (HEK-293)
ABC-X0125F 1 Vial

XpressTM Human Claudin-1 Over-expressing Stable Cell Line (HEK-293)

Sign In for Pricing
View Details