Galectin-14/LGALS14, Human (HEK293, His)
PPL13/LGALS14 is a mammalian placenta-specific galectin with placental specificity. Many placental lectins induce apoptosis of activated T cells and other leukocytes, thereby conferring immune tolerance to the recipient. Galectin-14/LGALS14 Protein, Human (HEK293, His) is the recombinant human-derived Galectin-14/LGALS14 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
Galectin-14/LGALS14 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/galectin-14-lgals14-protein-human-hek-293-his.html
Smiles
MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSCVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVFRDISLTRVLISD
Molecular Formula
56891 (Gene_ID) AAH22257.1 (M1-D139) (Accession)
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL
Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL
Filaggrin (Keratinocyte Differentiation Marker) (FLG/1561), CF405S conjugate, 0.1mg/mL
Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (CDH16/1532R), CF568 conjugate, 0.1mg/mL
