Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCERG1 Rabbit Polyclonal Antibody (HRP)

TCERG1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Urn1, CA150, TAF2S

UniProt

O14776

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TCERG1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AERGGDGGESERFNPGELRMAQQQALRFRGPAPPPNAVMRGPPPLMRPPP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

124kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006697

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Paramaecium, food vacuoles and nuclei doubly stained
Pr412e 7.6 x 2.6 cm

Paramaecium, food vacuoles and nuclei doubly stained

Sign In for Pricing
View Details
Monkey Adenylate Cyclase 7 (ADCY7) ELISA Kit
MBS9358736-01 48 Well

Monkey Adenylate Cyclase 7 (ADCY7) ELISA Kit

Sign In for Pricing
View Details
Monkey Adenylate Cyclase 7 (ADCY7) ELISA Kit
MBS9358736-02 96 Well

Monkey Adenylate Cyclase 7 (ADCY7) ELISA Kit

Sign In for Pricing
View Details
Monkey Adenylate Cyclase 7 (ADCY7) ELISA Kit
MBS9358736-03 5x 96 Well

Monkey Adenylate Cyclase 7 (ADCY7) ELISA Kit

Sign In for Pricing
View Details
Monkey Adenylate Cyclase 7 (ADCY7) ELISA Kit
MBS9358736-04 10x 96 Well

Monkey Adenylate Cyclase 7 (ADCY7) ELISA Kit

Sign In for Pricing
View Details
MCherry (Red Fluorescent Protein) discontinued
029840 100 µg

MCherry (Red Fluorescent Protein) discontinued

Sign In for Pricing
View Details