Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxa2 Rabbit Polyclonal Antibody (FITC)

Hoxa2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HOX1.11, Hox-1.1, AI324701, Hox-1.11

UniProt

P31245

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MNYEFEREIGFINSQPSLAECLTSFPPVADTFQSSSIKTSTLSHSTLIPP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034581

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCP1 beta (CCT2) Rabbit Polyclonal Antibody
TA374403 100 µL

TCP1 beta (CCT2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FKBP11 Double Nickase Plasmid (m)
sc-425832-NIC 20 µg

FKBP11 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Recombinant Novosphingobium aromaticivorans 1,4-alpha-glucan branching enzyme GlgB (glgB), partial
MBS1388105 Inquire

Recombinant Novosphingobium aromaticivorans 1,4-alpha-glucan branching enzyme GlgB (glgB), partial

Sign In for Pricing
View Details
TIM44 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-62763R-BF555-01 20 µL

TIM44 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
TIM44 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-62763R-BF555-02 100 µL

TIM44 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
MVP Polyclonal Antibody
E44H10488 100 µL

MVP Polyclonal Antibody

Sign In for Pricing
View Details