Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxa2 Rabbit Polyclonal Antibody (HRP)

Hoxa2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HOX1.11, Hox-1.1, AI324701, Hox-1.11

UniProt

P31245

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MNYEFEREIGFINSQPSLAECLTSFPPVADTFQSSSIKTSTLSHSTLIPP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034581

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Inhibitor of Metalloproteinases 4 (TIMP4)
T5589-04B 100 µg

Tissue Inhibitor of Metalloproteinases 4 (TIMP4)

Sign In for Pricing
View Details
Murine TGF beta 1 ELISA Kit
orb2705342 96 Tests

Murine TGF beta 1 ELISA Kit

Sign In for Pricing
View Details
Anti-Infliximab Antibody, pAb, Rabbit
A02061-40 40 µg

Anti-Infliximab Antibody, pAb, Rabbit

Sign In for Pricing
View Details
Methylphenidate (MPD) Rapid Test Strip – Urine
D-DOA63S50 50 Tests

Methylphenidate (MPD) Rapid Test Strip – Urine

Sign In for Pricing
View Details
CEBPD Polyclonal Antibody
MBS8569944-01 0.1 mL

CEBPD Polyclonal Antibody

Sign In for Pricing
View Details
CEBPD Polyclonal Antibody
MBS8569944-02 0.1 mL (AF405L)

CEBPD Polyclonal Antibody

Sign In for Pricing
View Details