Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tcea1 Rabbit Polyclonal Antibody (Biotin)

Tcea1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MGC116288

UniProt

Q4KLL0

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TAEEMASDELKEMRKNLTKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001020906

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Anti-β-hCG Antibody
TBS10122-0.25mg 0.25 mg

Monoclonal Anti-β-hCG Antibody

Sign In for Pricing
View Details
BEX4, ID (BEX4, BEXL1, NADE3, Protein BEX4, BEX1-like protein 1, Brain-expressed X-linked protein 4, Nerve growth factor receptor-associated protein 3) (APC)
MBS6278286-01 0.2 mL

BEX4, ID (BEX4, BEXL1, NADE3, Protein BEX4, BEX1-like protein 1, Brain-expressed X-linked protein 4, Nerve growth factor receptor-associated protein 3) (APC)

Sign In for Pricing
View Details
BEX4, ID (BEX4, BEXL1, NADE3, Protein BEX4, BEX1-like protein 1, Brain-expressed X-linked protein 4, Nerve growth factor receptor-associated protein 3) (APC)
MBS6278286-02 5x 0.2 mL

BEX4, ID (BEX4, BEXL1, NADE3, Protein BEX4, BEX1-like protein 1, Brain-expressed X-linked protein 4, Nerve growth factor receptor-associated protein 3) (APC)

Sign In for Pricing
View Details
IPPK Rabbit Polyclonal Antibody (BF680)
orb2497666 100 µL

IPPK Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
PRHOXNB (URAD) (NM_001105577) Human Over-expression Lysate
LS646625-20ug 20 µg

PRHOXNB (URAD) (NM_001105577) Human Over-expression Lysate

Sign In for Pricing
View Details
Hsp70 Antibody: ATTO 594
MBS804046-01 0.1 mg

Hsp70 Antibody: ATTO 594

Sign In for Pricing
View Details