Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tcea1 Rabbit Polyclonal Antibody (FITC)

Tcea1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MGC116288

UniProt

Q4KLL0

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TAEEMASDELKEMRKNLTKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001020906

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Dactylis glomerata (Orchard grass) (Cock's-foot grass) Major pollen allergen Dac g 4
MBS1115857-01 0.02 mg (E-Coli)

Recombinant Dactylis glomerata (Orchard grass) (Cock's-foot grass) Major pollen allergen Dac g 4

Sign In for Pricing
View Details
Recombinant Dactylis glomerata (Orchard grass) (Cock's-foot grass) Major pollen allergen Dac g 4
MBS1115857-02 0.02 mg (Yeast)

Recombinant Dactylis glomerata (Orchard grass) (Cock's-foot grass) Major pollen allergen Dac g 4

Sign In for Pricing
View Details
Recombinant Dactylis glomerata (Orchard grass) (Cock's-foot grass) Major pollen allergen Dac g 4
MBS1115857-03 0.1 mg (E-Coli)

Recombinant Dactylis glomerata (Orchard grass) (Cock's-foot grass) Major pollen allergen Dac g 4

Sign In for Pricing
View Details
Recombinant Dactylis glomerata (Orchard grass) (Cock's-foot grass) Major pollen allergen Dac g 4
MBS1115857-04 0.1 mg (Yeast)

Recombinant Dactylis glomerata (Orchard grass) (Cock's-foot grass) Major pollen allergen Dac g 4

Sign In for Pricing
View Details
Recombinant Dactylis glomerata (Orchard grass) (Cock's-foot grass) Major pollen allergen Dac g 4
MBS1115857-05 1 mg (E-Coli)

Recombinant Dactylis glomerata (Orchard grass) (Cock's-foot grass) Major pollen allergen Dac g 4

Sign In for Pricing
View Details
Recombinant Dactylis glomerata (Orchard grass) (Cock's-foot grass) Major pollen allergen Dac g 4
MBS1115857-06 1 mg (Yeast)

Recombinant Dactylis glomerata (Orchard grass) (Cock's-foot grass) Major pollen allergen Dac g 4

Sign In for Pricing
View Details