Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXC9 Rabbit Polyclonal Antibody (HRP)

HOXC9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HOX3, HOX3B

UniProt

P31274

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HOXC9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSATGPISNYYVDSLISHDNEDLLASRFPATGAHPAAARPSGLVPDCSDF

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_008828

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-CBL (Tyr774) Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-3090R-BF750 100 µL

Phospho-CBL (Tyr774) Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
PLEKHO1 Rabbit pAb, IRDye 800CW conjugated
orb2854266 100 µL

PLEKHO1 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Olfr1058 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
32553124 3x 1.0µg DNA

Olfr1058 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Human MRP1 MAb (Clone 464510)
MAB1929 100 µg

Human MRP1 MAb (Clone 464510)

Sign In for Pricing
View Details
MFAP4 (Microfibrillar-associated Protein 4) (MaxLight 650)
MBS6426658-01 0.1 mL

MFAP4 (Microfibrillar-associated Protein 4) (MaxLight 650)

Sign In for Pricing
View Details
MFAP4 (Microfibrillar-associated Protein 4) (MaxLight 650)
MBS6426658-02 5x 0.1 mL

MFAP4 (Microfibrillar-associated Protein 4) (MaxLight 650)

Sign In for Pricing
View Details