Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rorb Rabbit Polyclonal Antibody (Biotin)

Rorb Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

F1LQ88

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQRNCLIDRTNRNRCQHCR

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_002725756

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ubiquitin C (UBC) ELISA Kit
AE59476HU-01 48 Tests

Human Ubiquitin C (UBC) ELISA Kit

Sign In for Pricing
View Details
Human Ubiquitin C (UBC) ELISA Kit
AE59476HU-02 96 Tests

Human Ubiquitin C (UBC) ELISA Kit

Sign In for Pricing
View Details
Goat Kinesin-Like Protein KIF21A (KIF21A) ELISA Kit
MBS9937121 Inquire

Goat Kinesin-Like Protein KIF21A (KIF21A) ELISA Kit

Sign In for Pricing
View Details
Recombinant Bacillus thuringiensis subsp. konkukian UPF0398 protein BT9727_1438 (BT9727_1438)
MBS1477747-01 0.02 mg (E-Coli)

Recombinant Bacillus thuringiensis subsp. konkukian UPF0398 protein BT9727_1438 (BT9727_1438)

Sign In for Pricing
View Details
Recombinant Bacillus thuringiensis subsp. konkukian UPF0398 protein BT9727_1438 (BT9727_1438)
MBS1477747-02 0.1 mg (E-Coli)

Recombinant Bacillus thuringiensis subsp. konkukian UPF0398 protein BT9727_1438 (BT9727_1438)

Sign In for Pricing
View Details
Recombinant Bacillus thuringiensis subsp. konkukian UPF0398 protein BT9727_1438 (BT9727_1438)
MBS1477747-03 0.02 mg (Yeast)

Recombinant Bacillus thuringiensis subsp. konkukian UPF0398 protein BT9727_1438 (BT9727_1438)

Sign In for Pricing
View Details