Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rorb Rabbit Polyclonal Antibody (HRP)

Rorb Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

F1LQ88

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQRNCLIDRTNRNRCQHCR

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_002725756

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC87 Rabbit pAb, IRDye 800CW conjugated
orb2875008 100 µL

CCDC87 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
PGRMC1 (NM_006667) Human 3' UTR Clone
SC213320 10 µg

PGRMC1 (NM_006667) Human 3' UTR Clone

Sign In for Pricing
View Details
Rat Tpgs2 Pre-designed siRNA Set B
SI215063B 1 Each

Rat Tpgs2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Cetrimide Agar, Non-USP (Pseudosel Agar) (Powder)
MBS652973-01 500 g

Cetrimide Agar, Non-USP (Pseudosel Agar) (Powder)

Sign In for Pricing
View Details
Cetrimide Agar, Non-USP (Pseudosel Agar) (Powder)
MBS652973-02 5x 500 g

Cetrimide Agar, Non-USP (Pseudosel Agar) (Powder)

Sign In for Pricing
View Details
N Cadherin (CDH2) CytoSection
TS407170P5 25 Slides

N Cadherin (CDH2) CytoSection

Sign In for Pricing
View Details