Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOX15 Rabbit Polyclonal Antibody (Biotin)

SOX15 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SOX20, SOX26, SOX27

UniProt

O60248

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SOX15

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MALPGSSQDQAWSLEPPAATAAASSSSGPQEREGAGSPAAPGTLPLEKVK

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_008873

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Cytochrome b reductase 1 (CYBRD1) ELISA kit
GTR10387709 96 Well

Porcine Cytochrome b reductase 1 (CYBRD1) ELISA kit

Sign In for Pricing
View Details
AdmiRa-Off-hsa-miR-6875-3p Virus
mh7421 1.0 mL

AdmiRa-Off-hsa-miR-6875-3p Virus

Sign In for Pricing
View Details
DNA PKcs (PRKDC) pTyr2609 Rabbit Polyclonal Antibody
AP20936PU-N 100 µg

DNA PKcs (PRKDC) pTyr2609 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human Leucine-Rich Repeat Transmembrane Protein FLRT3/FLRT3 (C-6His)
C970-50ug 50 µg

Recombinant Human Leucine-Rich Repeat Transmembrane Protein FLRT3/FLRT3 (C-6His)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana PHD finger protein At1g33420 (At1g33420) , partial
MBS1410812 Inquire

Recombinant Arabidopsis thaliana PHD finger protein At1g33420 (At1g33420) , partial

Sign In for Pricing
View Details
PTBP1 Polyclonal Antibody
bs-55181R 100 µL

PTBP1 Polyclonal Antibody

Sign In for Pricing
View Details