Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB25 Rabbit Polyclonal Antibody (HRP)

ZBTB25 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KUP, ZNF46, C14orf51

UniProt

P24278

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZBTB25

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GNALAQRFQPYCDSWSDVSLKSSRLSQEHLDLPCALESELTQENVDTILV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_008908

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD68 (Macrophage Marker) (C68/2501), 0.2mg/mL
BNUB2501-500 1x 500 µL

CD68 (Macrophage Marker) (C68/2501), 0.2mg/mL

Sign In for Pricing
View Details
Human C10orf118 (CCDC186) activation kit by CRISPRa
GA110505 1 Kit

Human C10orf118 (CCDC186) activation kit by CRISPRa

Sign In for Pricing
View Details
OB Cadherin (CDH11) Rabbit Polyclonal Antibody
AP01246PU-N 100 µg

OB Cadherin (CDH11) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ubxn2a Mouse Gene Knockout Kit (CRISPR)
KN518631 1 Kit

Ubxn2a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Multi-Well Plates
DP35UR-9-NS 100 Units/Case

Multi-Well Plates

Sign In for Pricing
View Details
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1758), CF740 conjugate, 0.1mg/mL
BNC741758-100 1x 100 µL

CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1758), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details