Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF197 Rabbit Polyclonal Antibody (HRP)

ZNF197 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P18, VHLaK, ZNF20, ZNF166, ZKSCAN9, ZSCAN41, D3S1363E

UniProt

O14709

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF197

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NLTVHQKIHTDEKPCECDVSEKEFSQTSNLHLQQKIHTIEEFSWLQNTNE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

119kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_008922

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cct4 Mouse Gene Knockout Kit (CRISPR)
KN502851 1 Kit

Cct4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Bcl-X (Apoptosis Marker) (BCL2L1/2406), 0.2mg/mL
BNUB2406-500 1x 500 µL

Bcl-X (Apoptosis Marker) (BCL2L1/2406), 0.2mg/mL

Sign In for Pricing
View Details
GlcNac b-O-BSA Colloidal Gold Conjugate, 1mL 10nm
CCG-1013-10 1 mL

GlcNac b-O-BSA Colloidal Gold Conjugate, 1mL 10nm

Sign In for Pricing
View Details
Rhodamine 110
TRC-R318580-250MG 250 mg

Rhodamine 110

Sign In for Pricing
View Details
Human Alanyl tRNA synthetase 2 (AARS2) activation kit by CRISPRa
GA111543 1 Kit

Human Alanyl tRNA synthetase 2 (AARS2) activation kit by CRISPRa

Sign In for Pricing
View Details
Eliglustat Genz-399240
TRC-E203480-10MG 10 mg

Eliglustat Genz-399240

Sign In for Pricing
View Details